PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 407aa    MW: 44425.3 Da    PI: 9.252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016851.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-15120165147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W+ Ia+++  gR++k+c++rw++ 
      Pbr016851.1 120 RGHWRPAEDSKLKELVGQYGPQNWNIIAEKLD-GRSGKSCRLRWFNQ 165
                      899*****************************.***********996 PP

2Myb_DNA-binding53.84.6e-17173215246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Pbr016851.1 173 RAFSEEEEERLLVAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 215
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.477115166IPR017930Myb domain
SuperFamilySSF466892.92E-27119213IPR009057Homeodomain-like
SMARTSM007175.4E-13119168IPR001005SANT/Myb domain
PfamPF002492.1E-14120165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-25121173IPR009057Homeodomain-like
CDDcd001674.68E-12123164No hitNo description
PROSITE profilePS5129425.611167221IPR017930Myb domain
SMARTSM007172.1E-14171219IPR001005SANT/Myb domain
PfamPF002495.5E-14173214IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-20174219IPR009057Homeodomain-like
CDDcd001671.20E-11174214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGFQHLRSDC DGFTRYKDLN FLPPPPVSNQ LSLSNTFGRS STSAMGLGPF SPSLSQQTNK  60
SWSFQALENG GPKNISDHGV LFGVDLKTPV PLNLNLVGEE DDDEDRSPAG GRTSAKSCAR  120
GHWRPAEDSK LKELVGQYGP QNWNIIAEKL DGRSGKSCRL RWFNQLDPRI NKRAFSEEEE  180
ERLLVAHRLY GNKWAMIARL FPGRTDNAVK NHWHVIMARR HREQSNVFKR RKPSSPPPPS  240
PPAPPPHMVA NFPKNPSTST ESTISISTIN DDSTQSASTC TDLSLTPSNK PPPTFFTKFH  300
HFHHQQNFGS HIGTSSSDGG FKKMIGSNGN GFCRSTGPAR GVGAGAAAMK GVDTSGHQSD  360
SNSDISGDDS VTTTRTNLSL SGENQNLHHE KITTIHFIDF LGVGTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-321202204104C-Myb DNA-Binding Domain
1msf_C1e-321202204104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353183.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLM5VQV01e-164M5VQV0_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06320.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-71myb domain protein 105